Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHDC8B Rabbit Polyclonal Antibody (HRP)

KLHDC8B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CHL

UniProt

Q8IXV7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHDC8B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1569 Protein Vector (Rat) (pPB-N-His)
PV288603 500 ng

Olr1569 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
PIGW Protein Vector (Mouse) (pPM-C-HA)
PV216132 500 ng

PIGW Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
LightSpeed SacI
HTNP1049 100 Tests

LightSpeed SacI

Sign In for Pricing
View Details
Anti-PNP Antibody Picoband® (monoclonal, 7G5)-iFluor647 Conjugate
M00988-iFluor647 100 µg

Anti-PNP Antibody Picoband® (monoclonal, 7G5)-iFluor647 Conjugate

Sign In for Pricing
View Details
Sodium tripolyphosphate (STPP), 85%
HY-W019885 Inquire

Sodium tripolyphosphate (STPP), 85%

Sign In for Pricing
View Details
DNAJB4 (DnaJ Homolog Subfamily B Member 4, Heat Shock 40kD Protein 1 Homolog, HSP40 Homolog, Heat Shock Protein 40 Homolog, Human Liver DnaJ-like Protein, DNAJW, HLJ1) APC
MBS6136274-01 0.1 mL

DNAJB4 (DnaJ Homolog Subfamily B Member 4, Heat Shock 40kD Protein 1 Homolog, HSP40 Homolog, Heat Shock Protein 40 Homolog, Human Liver DnaJ-like Protein, DNAJW, HLJ1) APC

Sign In for Pricing
View Details