Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALT Rabbit Polyclonal Antibody (FITC)

GALT Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P07902

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GALT

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P4HB (Prolyl 4-hydroxylase Subunit beta, DSI, ERBA2L, GIT, P4Hbeta, Protein Disulfide Isomerase, PDI, PDIA1, PHDB, PO4DB, PO4HB, PROHB) discontinued
212450-01 50 µL

P4HB (Prolyl 4-hydroxylase Subunit beta, DSI, ERBA2L, GIT, P4Hbeta, Protein Disulfide Isomerase, PDI, PDIA1, PHDB, PO4DB, PO4HB, PROHB) discontinued

Sign In for Pricing
View Details
P4HB (Prolyl 4-hydroxylase Subunit beta, DSI, ERBA2L, GIT, P4Hbeta, Protein Disulfide Isomerase, PDI, PDIA1, PHDB, PO4DB, PO4HB, PROHB) discontinued
212450-02 100 µL

P4HB (Prolyl 4-hydroxylase Subunit beta, DSI, ERBA2L, GIT, P4Hbeta, Protein Disulfide Isomerase, PDI, PDIA1, PHDB, PO4DB, PO4HB, PROHB) discontinued

Sign In for Pricing
View Details
P4HB (Prolyl 4-hydroxylase Subunit beta, DSI, ERBA2L, GIT, P4Hbeta, Protein Disulfide Isomerase, PDI, PDIA1, PHDB, PO4DB, PO4HB, PROHB) discontinued
212450-03 200 µL

P4HB (Prolyl 4-hydroxylase Subunit beta, DSI, ERBA2L, GIT, P4Hbeta, Protein Disulfide Isomerase, PDI, PDIA1, PHDB, PO4DB, PO4HB, PROHB) discontinued

Sign In for Pricing
View Details
1-Cyclopropyl-2-azaspiro[3.3]heptane hydrochloride
DXC60913-01 50 mg

1-Cyclopropyl-2-azaspiro[3.3]heptane hydrochloride

Sign In for Pricing
View Details
1-Cyclopropyl-2-azaspiro[3.3]heptane hydrochloride
DXC60913-02 0.5 g

1-Cyclopropyl-2-azaspiro[3.3]heptane hydrochloride

Sign In for Pricing
View Details
Rabbit anti-TIGIT Recombinant Monoclonal Antibody [BLR235K]
MBS3906600-01 0.1 mg

Rabbit anti-TIGIT Recombinant Monoclonal Antibody [BLR235K]

Sign In for Pricing
View Details