Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTR Rabbit Polyclonal Antibody (FITC)

MTR Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MS, HMAG, cblG

UniProt

Q99707

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MTR

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

140kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD1a Antibody (OKT-6)
HY-P990869 1 Each

Anti-CD1a Antibody (OKT-6)

Sign In for Pricing
View Details
Recombinant Human Ciliary rootlet coiled-coil protein 2 (CRCC2), partial, Biotinylated
orb3007949-01 20 µg

Recombinant Human Ciliary rootlet coiled-coil protein 2 (CRCC2), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human Ciliary rootlet coiled-coil protein 2 (CRCC2), partial, Biotinylated
orb3007949-02 100 µg

Recombinant Human Ciliary rootlet coiled-coil protein 2 (CRCC2), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human Ciliary rootlet coiled-coil protein 2 (CRCC2), partial, Biotinylated
orb3007949-03 1 mg

Recombinant Human Ciliary rootlet coiled-coil protein 2 (CRCC2), partial, Biotinylated

Sign In for Pricing
View Details
GLYMA.06G110800 Antibody
PHY6524S 150 μg

GLYMA.06G110800 Antibody

Sign In for Pricing
View Details
Histone deacetylase 3 Polyclonal Antibody
MBS9415863-01 0.1 mg

Histone deacetylase 3 Polyclonal Antibody

Sign In for Pricing
View Details