Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tat Rabbit Polyclonal Antibody (HRP)

Tat Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P04694

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQAVHCLPATCF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036800

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genistein 4’-beta-D-Glucuronide
TRC-G349990-25MG 25 mg

Genistein 4’-beta-D-Glucuronide

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS704931 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human H2BW1 activation kit by CRISPRa
GA115982 1 Kit

Human H2BW1 activation kit by CRISPRa

Sign In for Pricing
View Details
CALHM6 (NM_001010919) Human Over-expression Lysate
LC423229 20 µg

CALHM6 (NM_001010919) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TMC4 activation kit by CRISPRa
GA115630 1 Kit

Human TMC4 activation kit by CRISPRa

Sign In for Pricing
View Details
LIPF Human Gene Knockout Kit (CRISPR)
KN421225 1 Kit

LIPF Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details