Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP3K15 Rabbit Polyclonal Antibody (FITC)

MAP3K15 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ASK3, bA723P2.3

UniProt

Q6ZN16

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MAP3K15

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YQNLLRQTLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001001671

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Soyabean HiVeg™ Medium, Granulated, Ster
GMV011GC-5KG 5 Kg

Soyabean HiVeg™ Medium, Granulated, Ster

Sign In for Pricing
View Details
PKLR, NT (Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-type/L-type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PK1, PKL) (Azide free) (HRP)
MBS6496258-01 0.2 mL

PKLR, NT (Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-type/L-type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PK1, PKL) (Azide free) (HRP)

Sign In for Pricing
View Details
PKLR, NT (Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-type/L-type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PK1, PKL) (Azide free) (HRP)
MBS6496258-02 5x 0.2 mL

PKLR, NT (Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-type/L-type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PK1, PKL) (Azide free) (HRP)

Sign In for Pricing
View Details
Phosphorodithioic acid, O, O-dimethyl S-2- (methylthio) ethyl ester
orb1985432-01 100 mg

Phosphorodithioic acid, O, O-dimethyl S-2- (methylthio) ethyl ester

Sign In for Pricing
View Details
Phosphorodithioic acid, O, O-dimethyl S-2- (methylthio) ethyl ester
orb1985432-02 25 mg

Phosphorodithioic acid, O, O-dimethyl S-2- (methylthio) ethyl ester

Sign In for Pricing
View Details
Phosphorodithioic acid, O, O-dimethyl S-2- (methylthio) ethyl ester
orb1985432-03 50 mg

Phosphorodithioic acid, O, O-dimethyl S-2- (methylthio) ethyl ester

Sign In for Pricing
View Details