Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC6 Rabbit Polyclonal Antibody (HRP)

TTC6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC119358, MGC119360, MGC119361

UniProt

Q86TZ1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TTC6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007796

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf39-set siRNA/shRNA/RNAi Lentivector (Human)
13689091 4x 500 ng

C11orf39-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
APC/Fire™ 750 anti-mouse CD38
GT00725 100 µg

APC/Fire™ 750 anti-mouse CD38

Sign In for Pricing
View Details
TRIM16L Rabbit pAb, PE-Cy5.5 conjugated
orb2847376 100 µL

TRIM16L Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Polyclonal Antibody to NODAL Modulator 1 (NOMO1)
TRV-0041623-01 20 µL

Polyclonal Antibody to NODAL Modulator 1 (NOMO1)

Sign In for Pricing
View Details
Polyclonal Antibody to NODAL Modulator 1 (NOMO1)
TRV-0041623-02 100 µL

Polyclonal Antibody to NODAL Modulator 1 (NOMO1)

Sign In for Pricing
View Details
Polyclonal Antibody to NODAL Modulator 1 (NOMO1)
TRV-0041623-03 200 µL

Polyclonal Antibody to NODAL Modulator 1 (NOMO1)

Sign In for Pricing
View Details