Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT17 Rabbit Polyclonal Antibody (FITC)

NUDT17 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P0C025

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUD17

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RMIPTMAEDKERVSTGTKFALKLWLQHLGRTPPPCKSAAYLDPGPAKEEW

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001012776

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Fibronectin Antibody (960632) [Alexa Fluor 350]
MAB8258AF350 0.1 mL

Mouse Monoclonal Fibronectin Antibody (960632) [Alexa Fluor 350]

Sign In for Pricing
View Details
NFKBIB (NF-kappa-B Inhibitor beta, NF-kappa-BIB, I-kappa-B-beta, IkB-B, IkB-beta, IkappaBbeta, Thyroid Receptor-interacting Protein 9, TR-interacting Protein 9, TRIP-9, IKBB, TRIP9) (MaxLight 650)
MBS6223453-01 0.1 mL

NFKBIB (NF-kappa-B Inhibitor beta, NF-kappa-BIB, I-kappa-B-beta, IkB-B, IkB-beta, IkappaBbeta, Thyroid Receptor-interacting Protein 9, TR-interacting Protein 9, TRIP-9, IKBB, TRIP9) (MaxLight 650)

Sign In for Pricing
View Details
NFKBIB (NF-kappa-B Inhibitor beta, NF-kappa-BIB, I-kappa-B-beta, IkB-B, IkB-beta, IkappaBbeta, Thyroid Receptor-interacting Protein 9, TR-interacting Protein 9, TRIP-9, IKBB, TRIP9) (MaxLight 650)
MBS6223453-02 5x 0.1 mL

NFKBIB (NF-kappa-B Inhibitor beta, NF-kappa-BIB, I-kappa-B-beta, IkB-B, IkB-beta, IkappaBbeta, Thyroid Receptor-interacting Protein 9, TR-interacting Protein 9, TRIP-9, IKBB, TRIP9) (MaxLight 650)

Sign In for Pricing
View Details
γ-synuclein (1H10D2) Alexa Fluor® 488
sc-65979 AF488 200 µg/mL

γ-synuclein (1H10D2) Alexa Fluor® 488

Sign In for Pricing
View Details
RNF113B Antibody
MBS7122332-01 0.05 mg

RNF113B Antibody

Sign In for Pricing
View Details
RNF113B Antibody
MBS7122332-02 0.1 mg

RNF113B Antibody

Sign In for Pricing
View Details