Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ME3 Rabbit Polyclonal Antibody (Biotin)

ME3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NADP-ME

UniProt

Q16798

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ME3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001014811

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab9p40, CT (RABEPK, RAB9P40, Rab9 effector protein with kelch motifs, 40kD Rab9 effector protein, p40) (MaxLight 750)
MBS6339919-01 0.1 mL

Rab9p40, CT (RABEPK, RAB9P40, Rab9 effector protein with kelch motifs, 40kD Rab9 effector protein, p40) (MaxLight 750)

Sign In for Pricing
View Details
Rab9p40, CT (RABEPK, RAB9P40, Rab9 effector protein with kelch motifs, 40kD Rab9 effector protein, p40) (MaxLight 750)
MBS6339919-02 5x 0.1 mL

Rab9p40, CT (RABEPK, RAB9P40, Rab9 effector protein with kelch motifs, 40kD Rab9 effector protein, p40) (MaxLight 750)

Sign In for Pricing
View Details
Fruit fly Non3 Rabbit Polyclonal Antibody (FITC)
orb2571033 200 µL

Fruit fly Non3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Borrelia hermsii Variable small protein 13 (vsp13)
MBS1421765-01 0.02 mg (E-Coli)

Recombinant Borrelia hermsii Variable small protein 13 (vsp13)

Sign In for Pricing
View Details
Recombinant Borrelia hermsii Variable small protein 13 (vsp13)
MBS1421765-02 0.1 mg (E-Coli)

Recombinant Borrelia hermsii Variable small protein 13 (vsp13)

Sign In for Pricing
View Details
Recombinant Borrelia hermsii Variable small protein 13 (vsp13)
MBS1421765-03 0.02 mg (Yeast)

Recombinant Borrelia hermsii Variable small protein 13 (vsp13)

Sign In for Pricing
View Details