Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ME3 Rabbit Polyclonal Antibody (HRP)

ME3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NADP-ME

UniProt

Q16798

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ME3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001014811

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zmynd11 (NM_144516) Mouse Tagged ORF Clone Lentiviral Particle
MR223905L4V 200 µL

Zmynd11 (NM_144516) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CNOT3 Human Pre-designed siRNA Set A
HY-RS02903 1 Set

CNOT3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Sheep Mismatch Repair Endonuclease PMS2 (PMS2) ELISA Kit
MBS9933001-01 48 Well

Sheep Mismatch Repair Endonuclease PMS2 (PMS2) ELISA Kit

Sign In for Pricing
View Details
Sheep Mismatch Repair Endonuclease PMS2 (PMS2) ELISA Kit
MBS9933001-02 96 Well

Sheep Mismatch Repair Endonuclease PMS2 (PMS2) ELISA Kit

Sign In for Pricing
View Details
Sheep Mismatch Repair Endonuclease PMS2 (PMS2) ELISA Kit
MBS9933001-03 5x 96 Well

Sheep Mismatch Repair Endonuclease PMS2 (PMS2) ELISA Kit

Sign In for Pricing
View Details
Sheep Mismatch Repair Endonuclease PMS2 (PMS2) ELISA Kit
MBS9933001-04 10x 96 Well

Sheep Mismatch Repair Endonuclease PMS2 (PMS2) ELISA Kit

Sign In for Pricing
View Details