Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3H Rabbit Polyclonal Antibody (FITC)

POLR3H Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C25, RPC8, RPC22.9

UniProt

B0QYH9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POLR3H

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001018062

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Syncollin (SYCN) ELISA Kit
RD-SYCN-Hu-48Tests 48 Tests

Human Syncollin (SYCN) ELISA Kit

Sign In for Pricing
View Details
Cystatin C Mouse ELISA Kit
MBS355271-01 96 Tests

Cystatin C Mouse ELISA Kit

Sign In for Pricing
View Details
Cystatin C Mouse ELISA Kit
MBS355271-02 5x 96 Tests

Cystatin C Mouse ELISA Kit

Sign In for Pricing
View Details
Recombinant Salmonella typhi P4 prophage-derived uncharacterized protein t2655 (t2655)
MBS1142980-01 0.02 mg (E-Coli)

Recombinant Salmonella typhi P4 prophage-derived uncharacterized protein t2655 (t2655)

Sign In for Pricing
View Details
Recombinant Salmonella typhi P4 prophage-derived uncharacterized protein t2655 (t2655)
MBS1142980-02 0.1 mg (E-Coli)

Recombinant Salmonella typhi P4 prophage-derived uncharacterized protein t2655 (t2655)

Sign In for Pricing
View Details
Recombinant Salmonella typhi P4 prophage-derived uncharacterized protein t2655 (t2655)
MBS1142980-03 0.02 mg (Yeast)

Recombinant Salmonella typhi P4 prophage-derived uncharacterized protein t2655 (t2655)

Sign In for Pricing
View Details