Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA8 Rabbit Polyclonal Antibody (FITC)

PSMA8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PSMA7L

UniProt

Q8TAA3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human PSA7L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISALIVGFDDDGISRL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_653263

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B polyclonal Antibody, HRP conjugated
MBS1497366-01 0.05 mg

Rabbit anti-Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B polyclonal Antibody, HRP conjugated
MBS1497366-02 0.1 mg

Rabbit anti-Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B polyclonal Antibody, HRP conjugated
MBS1497366-03 5x 0.1 mg

Rabbit anti-Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Human ITGAE Protein Lysate
MBS8413743-01 0.02 mg

Human ITGAE Protein Lysate

Sign In for Pricing
View Details
Human ITGAE Protein Lysate
MBS8413743-02 5x 0.02 mg

Human ITGAE Protein Lysate

Sign In for Pricing
View Details
Human Caspase 9 (CASP9) ELISA Kit
JL14734-01 48 Tests

Human Caspase 9 (CASP9) ELISA Kit

Sign In for Pricing
View Details