Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT11 Rabbit Polyclonal Antibody (HRP)

TRMT11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRM11, MDS024, C6orf75, TRMT11-1

UniProt

Q7Z4G4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRMT11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001026882

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse membrane-bound HLA-E (mHLA-E) ELISA Kit
YP-W20951-01 48 Tests

Mouse membrane-bound HLA-E (mHLA-E) ELISA Kit

Sign In for Pricing
View Details
Mouse membrane-bound HLA-E (mHLA-E) ELISA Kit
YP-W20951-02 96 Tests

Mouse membrane-bound HLA-E (mHLA-E) ELISA Kit

Sign In for Pricing
View Details
LINC00555 AAV Vector (Human) (CMV)
26838101 1 µg

LINC00555 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
SNX6 Rabbit Polyclonal Antibody
E28PB1391 100 µL

SNX6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPR31 ORF Vector (Human) (pORF)
ORF020374 1.0 µg DNA

GPR31 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Ccr1l1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3942907 1.0 µg DNA

Ccr1l1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details