Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naa60 Rabbit Polyclonal Antibody (FITC)

Naa60 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HAT4, NatF, Nat15, RGD1308915

UniProt

Q3MHC1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Naa60

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001014248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Calretinin Antibody (CALB2/7029R) [DyLight 405]
NBP3-14032V 0.1 mL

Rabbit Monoclonal Calretinin Antibody (CALB2/7029R) [DyLight 405]

Sign In for Pricing
View Details
Recombinant Hepatitis B Surface Antigen preS2
7-07505 50 µg

Recombinant Hepatitis B Surface Antigen preS2

Sign In for Pricing
View Details
Bovine Actin binding LIM protein 2 (ABLIM2) ELISA kit
GTR10454815 96 Well

Bovine Actin binding LIM protein 2 (ABLIM2) ELISA kit

Sign In for Pricing
View Details
Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1) -VLPs
CSB-MP023626HU (A4)-01 20 µg

Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1) -VLPs

Sign In for Pricing
View Details
Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1) -VLPs
CSB-MP023626HU (A4)-02 100 µg

Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1) -VLPs

Sign In for Pricing
View Details
Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1) -VLPs
CSB-MP023626HU (A4)-03 1 mg

Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1) -VLPs

Sign In for Pricing
View Details