Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naa60 Rabbit Polyclonal Antibody (HRP)

Naa60 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HAT4, NatF, Nat15, RGD1308915

UniProt

Q3MHC1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Naa60

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001014248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASK Rabbit Polyclonal Antibody (Cy3)
orb991521 100 µL

CASK Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
PELP1 Antibody / Proline-, glutamic acid- and leucine-rich protein 1
F54623-0.08ML 0.08 mL

PELP1 Antibody / Proline-, glutamic acid- and leucine-rich protein 1

Sign In for Pricing
View Details
PPM1H Antibody, HRP conjugated
CSB-PA892345LB01HU-01 50 µg

PPM1H Antibody, HRP conjugated

Sign In for Pricing
View Details
PPM1H Antibody, HRP conjugated
CSB-PA892345LB01HU-02 100 µg

PPM1H Antibody, HRP conjugated

Sign In for Pricing
View Details
Human Osteoprotegerin/TNFRSF11B Recombinant Protein
PROTO00300-250ug 250 µg

Human Osteoprotegerin/TNFRSF11B Recombinant Protein

Sign In for Pricing
View Details
N1- (2- (Tritylthio) ethyl) propane-1,3-diamine
460198-01 500 mg

N1- (2- (Tritylthio) ethyl) propane-1,3-diamine

Sign In for Pricing
View Details