Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naa60 Rabbit Polyclonal Antibody (HRP)

Naa60 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HAT4, NatF, Nat15, RGD1308915

UniProt

Q3MHC1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Naa60

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001014248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MSANTD4 shRNA (UAS) - Lentiviral human MSANTD4 shRNA (UAS, RFP) plasmid
GTR15349300 1 Vial

Lentiviral human MSANTD4 shRNA (UAS) - Lentiviral human MSANTD4 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
FMN1 Rabbit Polyclonal Antibody (APC)
orb2615292 100 µg

FMN1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Anti-AKAP 95/AKAP8 Antibody Picoband®, Carrier-free
A05133-2-carrier-free 100 µg/Vial

Anti-AKAP 95/AKAP8 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Human SORBS1 qPCR Primer Pair
QH07641S 200 Tests

Human SORBS1 qPCR Primer Pair

Sign In for Pricing
View Details
1-​ (Chloromethyl) ​-​4-​[ (trifluoromethyl) ​thio]​-benzene
408361-01 250 mg

1-​ (Chloromethyl) ​-​4-​[ (trifluoromethyl) ​thio]​-benzene

Sign In for Pricing
View Details
1-​ (Chloromethyl) ​-​4-​[ (trifluoromethyl) ​thio]​-benzene
408361-02 1 g

1-​ (Chloromethyl) ​-​4-​[ (trifluoromethyl) ​thio]​-benzene

Sign In for Pricing
View Details