Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT15 Rabbit Polyclonal Antibody (FITC)

NAT15 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HAT4, NatF, NAT15, hNaa60

UniProt

Q9H7X0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NAT15

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001077070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDS1 Antibody
orb852679 2 mg

ZDS1 Antibody

Sign In for Pricing
View Details
Simian FDP (Fibrinogen Degradation Product) ELISA Kit
ELK11573-01 48 Tests

Simian FDP (Fibrinogen Degradation Product) ELISA Kit

Sign In for Pricing
View Details
Simian FDP (Fibrinogen Degradation Product) ELISA Kit
ELK11573-02 96 Tests

Simian FDP (Fibrinogen Degradation Product) ELISA Kit

Sign In for Pricing
View Details
Simian FDP (Fibrinogen Degradation Product) ELISA Kit
ELK11573-03 5x 96 Tests

Simian FDP (Fibrinogen Degradation Product) ELISA Kit

Sign In for Pricing
View Details
ELYS Rabbit Polyclonal Antibody (Cy5.5)
orb1016638 100 µL

ELYS Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Human Uncharacterized protein KIAA1383, KIAA1383 ELISA Kit
MBS9325650-01 48 Well

Human Uncharacterized protein KIAA1383, KIAA1383 ELISA Kit

Sign In for Pricing
View Details