Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmgcs1 Rabbit Polyclonal Antibody (HRP)

Hmgcs1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B130032C06Rik

UniProt

Q8JZK9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hmgcs1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVRVDEKHRRTYARRPFTNDHSLDEGMGLVHSNTATEHIPSPAKKVPRLP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_666054

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrp12 AAV siRNA Pooled Vector
27605164 1.0 µg

Lrp12 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Fluor430-conjugated Polyclonal Goat Anti-Rabbit IgG (H+L) (Non cross with Mouse IgG) Secondary Antibody
APS0146-01 200 µL

Fluor430-conjugated Polyclonal Goat Anti-Rabbit IgG (H+L) (Non cross with Mouse IgG) Secondary Antibody

Sign In for Pricing
View Details
Fluor430-conjugated Polyclonal Goat Anti-Rabbit IgG (H+L) (Non cross with Mouse IgG) Secondary Antibody
APS0146-02 500 µL

Fluor430-conjugated Polyclonal Goat Anti-Rabbit IgG (H+L) (Non cross with Mouse IgG) Secondary Antibody

Sign In for Pricing
View Details
Mouse Tm2d2 Pre-designed siRNA Set A
SI114679A 1 Each

Mouse Tm2d2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
METTL25 Double Nickase Plasmid (h)
sc-413574-NIC 20 µg

METTL25 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Human PCID2 (NM_001127202) AAV Particle
RC227374A1V 250 µL

Human PCID2 (NM_001127202) AAV Particle

Sign In for Pricing
View Details