Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFNG Rabbit Polyclonal Antibody (Biotin)

MFNG Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

O00587

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MFNG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP2 (ARTD2, Poly (ADP-ribose) Polymerase 2, ADP-ribosyltransferase Diphtheria Toxin-like 2, NAD (+) ADP-ribosyltransferase 2)
207326 100 µL

PARP2 (ARTD2, Poly (ADP-ribose) Polymerase 2, ADP-ribosyltransferase Diphtheria Toxin-like 2, NAD (+) ADP-ribosyltransferase 2)

Sign In for Pricing
View Details
Fibroblast growth factor 8 FGF8 Rabbit Polyclonal Antibody (FITC)
orb2579706 100 µg

Fibroblast growth factor 8 FGF8 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human DRC12 Pre-designed siRNA Set B
SI004556B 1 Each

Human DRC12 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Phospho-NLK (Thr298) Rabbit Polyclonal Antibody (PE)
orb506083 100 µL

Phospho-NLK (Thr298) Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
IRAK-1/4 Inhibitor
9578-25 25 mg

IRAK-1/4 Inhibitor

Sign In for Pricing
View Details
Bovine Prostaglandin F Receptor FP ELISA Kit
BG-BVN10990 1 Each

Bovine Prostaglandin F Receptor FP ELISA Kit

Sign In for Pricing
View Details