Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFNG Rabbit Polyclonal Antibody (HRP)

MFNG Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O00587

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MFNG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PF4V1 Peptide - middle region
orb2016898 100 µg

PF4V1 Peptide - middle region

Sign In for Pricing
View Details
Anti-UBE2Z Rabbit pAb
GB114652-50 50 μL

Anti-UBE2Z Rabbit pAb

Sign In for Pricing
View Details
HSP70 Rabbit Polyclonal Antibody (PE-Cy7)
orb871134 100 µL

HSP70 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
HBG1 (Hemoglobin Subunit gamma-1, Gamma-1-globin, Hb F Agamma, Hemoglobin gamma-1 Chain, Hemoglobin gamma-A Chain) (MaxLight 490)
MBS6201161-01 0.1 mL

HBG1 (Hemoglobin Subunit gamma-1, Gamma-1-globin, Hb F Agamma, Hemoglobin gamma-1 Chain, Hemoglobin gamma-A Chain) (MaxLight 490)

Sign In for Pricing
View Details
HBG1 (Hemoglobin Subunit gamma-1, Gamma-1-globin, Hb F Agamma, Hemoglobin gamma-1 Chain, Hemoglobin gamma-A Chain) (MaxLight 490)
MBS6201161-02 5x 0.1 mL

HBG1 (Hemoglobin Subunit gamma-1, Gamma-1-globin, Hb F Agamma, Hemoglobin gamma-1 Chain, Hemoglobin gamma-A Chain) (MaxLight 490)

Sign In for Pricing
View Details
Thyroglobulin (TG) BioAssayTM ELISA Kit (Rat)
028390 96 Tests

Thyroglobulin (TG) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details