Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFNG Rabbit Polyclonal Antibody (HRP)

MFNG Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O00587

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MFNG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Chloride Voltage-Gated Channel Kb (CLCNKB) ELISA Kit
abx507180 96 Tests

Rat Chloride Voltage-Gated Channel Kb (CLCNKB) ELISA Kit

Sign In for Pricing
View Details
INPP5J Antibody
E19-9741-1 50 µg - 50 µL

INPP5J Antibody

Sign In for Pricing
View Details
ARHGAP6 (Rho GTPase Activating Protein 6)
475555 100 µL

ARHGAP6 (Rho GTPase Activating Protein 6)

Sign In for Pricing
View Details
Pou4f2 3'UTR GFP Stable Cell Line
TU266580 1.0 mL

Pou4f2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Uimc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3277105 3x 1.0 µg

Uimc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
NUDT1 Antibody (HRP)
orb49102-01 50 µg

NUDT1 Antibody (HRP)

Sign In for Pricing
View Details