Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYGB Rabbit Polyclonal Antibody (Biotin)

PYGB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GPBB

UniProt

P11216

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PYGB

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDLE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_002853

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 490)
C2399-07G2-ML490 100 µL

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 490)

Sign In for Pricing
View Details
Jurkat, Clone E6-1 Cell Complete Medium
CM-0129 4x 125 mL

Jurkat, Clone E6-1 Cell Complete Medium

Sign In for Pricing
View Details
Human Sp7/Osterix ELISA Kit
orb564645-01 48 Tests

Human Sp7/Osterix ELISA Kit

Sign In for Pricing
View Details
Human Sp7/Osterix ELISA Kit
orb564645-02 96 Tests

Human Sp7/Osterix ELISA Kit

Sign In for Pricing
View Details
HSPA13 (Heat Shock 70kD Protein 13, Stress 70 Protein Chaperone Microsome-associated 60kD Protein, Microsomal Stress 70 Protein ATPase Core, STCH) (MaxLight 550)
128123-ML550 100 µL

HSPA13 (Heat Shock 70kD Protein 13, Stress 70 Protein Chaperone Microsome-associated 60kD Protein, Microsomal Stress 70 Protein ATPase Core, STCH) (MaxLight 550)

Sign In for Pricing
View Details
ARHGDIG Antibody
CSB-PA003973-01 50 µg

ARHGDIG Antibody

Sign In for Pricing
View Details