Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rngtt Rabbit Polyclonal Antibody (Biotin)

Rngtt Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HCE, MCE1, AU020997

UniProt

O55236

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rngtt

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036014

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-mmu-miR-7242-3p Virus
mm2000 250 µL

AdmiRa-mmu-miR-7242-3p Virus

Sign In for Pricing
View Details
Porcine Interleukin-12 receptor subunit beta-2 (IL12RB2) ELISA Kit
MBS7216820-01 48 Well

Porcine Interleukin-12 receptor subunit beta-2 (IL12RB2) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin-12 receptor subunit beta-2 (IL12RB2) ELISA Kit
MBS7216820-02 96 Well

Porcine Interleukin-12 receptor subunit beta-2 (IL12RB2) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin-12 receptor subunit beta-2 (IL12RB2) ELISA Kit
MBS7216820-03 5x 96 Well

Porcine Interleukin-12 receptor subunit beta-2 (IL12RB2) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin-12 receptor subunit beta-2 (IL12RB2) ELISA Kit
MBS7216820-04 10x 96 Well

Porcine Interleukin-12 receptor subunit beta-2 (IL12RB2) ELISA Kit

Sign In for Pricing
View Details
Cadherin-23 Polyclonal Antibody
ABP56148-01 30 µL

Cadherin-23 Polyclonal Antibody

Sign In for Pricing
View Details