Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rngtt Rabbit Polyclonal Antibody (Biotin)

Rngtt Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HCE, MCE1, AU020997

UniProt

O55236

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rngtt

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036014

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC anti-p53
GT19076 25 Tests

FITC anti-p53

Sign In for Pricing
View Details
SIGMAR1 Peptide
DF7363-BP 1 mg

SIGMAR1 Peptide

Sign In for Pricing
View Details
Monkey Anaphase-promoting complex subunit 10 (ANAPC10) ELISA Kit
MBS7251163-01 48 Well

Monkey Anaphase-promoting complex subunit 10 (ANAPC10) ELISA Kit

Sign In for Pricing
View Details
Monkey Anaphase-promoting complex subunit 10 (ANAPC10) ELISA Kit
MBS7251163-02 96 Well

Monkey Anaphase-promoting complex subunit 10 (ANAPC10) ELISA Kit

Sign In for Pricing
View Details
Monkey Anaphase-promoting complex subunit 10 (ANAPC10) ELISA Kit
MBS7251163-03 5x 96 Well

Monkey Anaphase-promoting complex subunit 10 (ANAPC10) ELISA Kit

Sign In for Pricing
View Details
Monkey Anaphase-promoting complex subunit 10 (ANAPC10) ELISA Kit
MBS7251163-04 10x 96 Well

Monkey Anaphase-promoting complex subunit 10 (ANAPC10) ELISA Kit

Sign In for Pricing
View Details