Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rngtt Rabbit Polyclonal Antibody (FITC)

Rngtt Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HCE, MCE1, AU020997

UniProt

O55236

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rngtt

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036014

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAF1 (H-2) : m-IgG Fc BP-HRP Bundle
sc-531440 1 Kit

MAF1 (H-2) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
MoTP, Induces melanocyte ablation
TBI1124-25MG 25 mg

MoTP, Induces melanocyte ablation

Sign In for Pricing
View Details
D8Ertd82e Mouse shRNA Plasmid (Locus ID 244418)
TL507452 1 Kit

D8Ertd82e Mouse shRNA Plasmid (Locus ID 244418)

Sign In for Pricing
View Details
LDOC1 shRNA Plasmid (m)
sc-146694-SH 20 µg

LDOC1 shRNA Plasmid (m)

Sign In for Pricing
View Details
Mouse Monoclonal lactamase, beta 2 Antibody (OTI2F9) [mFluor Violet 610 SE]
NBP2-71901MFV610 0.1 mL

Mouse Monoclonal lactamase, beta 2 Antibody (OTI2F9) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Vmn1r69 (NM_145842) Mouse Tagged Lenti ORF Clone
MR223371L3 10 µg

Vmn1r69 (NM_145842) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details