Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gyg Rabbit Polyclonal Antibody (FITC)

Gyg Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GN1, Gyg1, AU017667

UniProt

Q9R062

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038783

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM54 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV658694 1.0 µg DNA

TMEM54 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Sulphanitran antibody
20-1708 100 ul

Sulphanitran antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Lipoyl synthase (lipA)
MBS1133783-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Lipoyl synthase (lipA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Lipoyl synthase (lipA)
MBS1133783-02 0.02 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC Lipoyl synthase (lipA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Lipoyl synthase (lipA)
MBS1133783-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Lipoyl synthase (lipA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Lipoyl synthase (lipA)
MBS1133783-04 0.1 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC Lipoyl synthase (lipA)

Sign In for Pricing
View Details