Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gyg Rabbit Polyclonal Antibody (HRP)

Gyg Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GN1, Gyg1, AU017667

UniProt

Q9R062

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038783

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Acetamido-2-deoxy-D-glucuronic Acid
TRC-A158270-50MG 50 mg

2-Acetamido-2-deoxy-D-glucuronic Acid

Sign In for Pricing
View Details
Mouse Cryba4 activation kit by CRISPRa
GA200898 1 Kit

Mouse Cryba4 activation kit by CRISPRa

Sign In for Pricing
View Details
RET Human qPCR Primer Pair (NM_020975)
HP233916 200 Reactions

RET Human qPCR Primer Pair (NM_020975)

Sign In for Pricing
View Details
Human CXCL2/MIP-2 Recombinant Rabbit monoclonal Antibody
HA725248 100 µL

Human CXCL2/MIP-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
NRPE Trifluoroacetic Acid Salt (Technical Grade)
TRC-N900100-5MG 5 mg

NRPE Trifluoroacetic Acid Salt (Technical Grade)

Sign In for Pricing
View Details
Chlorotriethoxytitanium (Contains <10% Chlorotriisopropoxytitanium)
TRC-C421758-1G 1 g

Chlorotriethoxytitanium (Contains <10% Chlorotriisopropoxytitanium)

Sign In for Pricing
View Details