Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nmt2 Rabbit Polyclonal Antibody (HRP)

Nmt2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q700Q7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Nmt2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_997473

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Slc28a1 shRNA (UAS) - Lentiviral mouse Slc28a1 shRNA (UAS) plasmid
GTR15250039 1 Vial

Lentiviral mouse Slc28a1 shRNA (UAS) - Lentiviral mouse Slc28a1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Mouse Interleukin 10 CLIA Kit
MBS8426324-01 1 Kit

Mouse Interleukin 10 CLIA Kit

Sign In for Pricing
View Details
Mouse Interleukin 10 CLIA Kit
MBS8426324-02 5x 1 Kit

Mouse Interleukin 10 CLIA Kit

Sign In for Pricing
View Details
LIG4 Polyclonal Antibody
E-AB-67123-01 60 µL

LIG4 Polyclonal Antibody

Sign In for Pricing
View Details
LIG4 Polyclonal Antibody
E-AB-67123-02 120 µL

LIG4 Polyclonal Antibody

Sign In for Pricing
View Details
LIG4 Polyclonal Antibody
E-AB-67123-03 200 µL

LIG4 Polyclonal Antibody

Sign In for Pricing
View Details