Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL1 Rabbit Polyclonal Antibody (FITC)

METTL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TRM8, TRMT8, C12orf1, YDL201w

UniProt

Q9UBP6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human METTL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005362

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS501091 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
PAEP (NM_002571) Human Over-expression Lysate
LC419242 20 µg

PAEP (NM_002571) Human Over-expression Lysate

Sign In for Pricing
View Details
Beta Catenin Rabbit Polyclonal Antibody
ER0805 100 µL

Beta Catenin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C Reactive Protein (CRP) (19-224) Mouse Monoclonal Antibody [Clone ID: 5A9]
AM09005PU-N 100 µL

C Reactive Protein (CRP) (19-224) Mouse Monoclonal Antibody [Clone ID: 5A9]

Sign In for Pricing
View Details
Rasgrp1 Mouse Gene Knockout Kit (CRISPR)
KN514503 1 Kit

Rasgrp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Citrate-dextrose Solution (ACD)
TRC-C520515-50ML 50 mL

Citrate-dextrose Solution (ACD)

Sign In for Pricing
View Details