Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL1 Rabbit Polyclonal Antibody (HRP)

METTL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRM8, TRMT8, C12orf1, YDL201w

UniProt

Q9UBP6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human METTL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005362

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNIH4 Human Gene Knockout Kit (CRISPR)
KN400050 1 Kit

CNIH4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PTCD2 activation kit by CRISPRa
GA112642 1 Kit

Human PTCD2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human HTR2B activation kit by CRISPRa
GA102285 1 Kit

Human HTR2B activation kit by CRISPRa

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Rabbit Polyclonal Antibody
TA378617 100 µL

Myeloperoxidase (MPO) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human FSTL4 activation kit by CRISPRa
GA108041 1 Kit

Human FSTL4 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein A-I/ApoAI Protein
PKSH032082-01 10 µg

Recombinant Human Apolipoprotein A-I/ApoAI Protein

Sign In for Pricing
View Details