Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL1 Rabbit Polyclonal Antibody (HRP)

METTL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRM8, TRMT8, C12orf1, YDL201w

UniProt

Q9UBP6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human METTL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_075422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human TNNC1 (Troponin C Type 1) ELISA Kit
E-UNEL-H0293-01 5x 96 Tests

Uncoated Human TNNC1 (Troponin C Type 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TNNC1 (Troponin C Type 1) ELISA Kit
E-UNEL-H0293-02 15x 96 Tests

Uncoated Human TNNC1 (Troponin C Type 1) ELISA Kit

Sign In for Pricing
View Details
Rfx1 Mouse Gene Knockout Kit (CRISPR)
KN514705 1 Kit

Rfx1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Lung: right lower lobe
CR562443 5 µg

Tissue Total RNA, Lung: right lower lobe

Sign In for Pricing
View Details
Aebp2 Mouse Gene Knockout Kit (CRISPR)
KN500944 1 Kit

Aebp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RNF149 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D9]
TA810426BM 100 µL

RNF149 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D9]

Sign In for Pricing
View Details