Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCMT1 Rabbit Polyclonal Antibody (HRP)

PCMT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PIMT

UniProt

P22061

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCMT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005380

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF22 (NM_001300812) Human Tagged ORF Clone
RG236205 10 µg

FGF22 (NM_001300812) Human Tagged ORF Clone

Sign In for Pricing
View Details
Shugoshin (SGO1) (NM_001012412) Human Over-expression Lysate
LC422850 20 µg

Shugoshin (SGO1) (NM_001012412) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Nemf activation kit by CRISPRa
GA206659 1 Kit

Mouse Nemf activation kit by CRISPRa

Sign In for Pricing
View Details
PCOLCE (NM_002593) Human Over-expression Lysate
LY419210 100 µg

PCOLCE (NM_002593) Human Over-expression Lysate

Sign In for Pricing
View Details
EZH2 / KMT6 (EZH2/2536), CF640R conjugate, 0.1mg/mL
BNC402536-100 1x 100 µL

EZH2 / KMT6 (EZH2/2536), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,2-Diselanediyldiethanamine Dihydrochloride
TRC-D493318-50MG 50 mg

2,2-Diselanediyldiethanamine Dihydrochloride

Sign In for Pricing
View Details