Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pygm Rabbit Polyclonal Antibody (HRP)

Pygm Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P, PG, AI115133

UniProt

Q9WUB3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_035354

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NKX6-1 Polyclonal Antibody
PHF68201 100 μg

Anti-NKX6-1 Polyclonal Antibody

Sign In for Pricing
View Details
GLIPR1 (Glioma Pathogenesis-related Protein 1, GliPR 1, Protein RTVP-1, GLIPR, RTVP1) (PE)
127345-PE 100 µL

GLIPR1 (Glioma Pathogenesis-related Protein 1, GliPR 1, Protein RTVP-1, GLIPR, RTVP1) (PE)

Sign In for Pricing
View Details
XRCC1 Recombinant Protein (Rat)
RP237656 100 µg

XRCC1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
CYTH1 Antibody
orb1276543 100 µL

CYTH1 Antibody

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus Putative pterin-4-alpha-carbinolamine dehydratase (M164_0005)
MBS1119828-01 0.02 mg (E-Coli)

Recombinant Sulfolobus islandicus Putative pterin-4-alpha-carbinolamine dehydratase (M164_0005)

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus Putative pterin-4-alpha-carbinolamine dehydratase (M164_0005)
MBS1119828-02 0.1 mg (E-Coli)

Recombinant Sulfolobus islandicus Putative pterin-4-alpha-carbinolamine dehydratase (M164_0005)

Sign In for Pricing
View Details