Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pygm Rabbit Polyclonal Antibody (HRP)

Pygm Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P, PG, AI115133

UniProt

Q9WUB3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_035354

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement Factor C4d (C4d) (MaxLight 750) discontinued
214773-ML750 100 µL

Complement Factor C4d (C4d) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7237549-01 48 Well

Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7237549-02 96 Well

Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7237549-03 5x 96 Well

Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit
MBS7237549-04 10x 96 Well

Chicken Outer dense fiber protein 1 (ODF1) ELISA Kit

Sign In for Pricing
View Details
Mouse sCD163 ELISA Kit
orb566203-01 48 Tests

Mouse sCD163 ELISA Kit

Sign In for Pricing
View Details