Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3F Rabbit Polyclonal Antibody (Biotin)

POLR3F Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C34, RPC6, RPC39

UniProt

Q9H1D9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POLR3F

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006457

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAP Polyclonal Antibody, Cy5.5 Conjugated
bs-3862R-Cy5.5 100 µL

SCAP Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Pig Blue ear virus antibody (PRRS-Ab) ELISA Kit
JL21926-01 48 Tests

Pig Blue ear virus antibody (PRRS-Ab) ELISA Kit

Sign In for Pricing
View Details
Pig Blue ear virus antibody (PRRS-Ab) ELISA Kit
JL21926-02 96 Tests

Pig Blue ear virus antibody (PRRS-Ab) ELISA Kit

Sign In for Pricing
View Details
Porcine FGF6 (Fibroblast Growth Factor 6) ELISA Kit
MBS2509153-01 24 Tests

Porcine FGF6 (Fibroblast Growth Factor 6) ELISA Kit

Sign In for Pricing
View Details
Porcine FGF6 (Fibroblast Growth Factor 6) ELISA Kit
MBS2509153-02 48 Tests

Porcine FGF6 (Fibroblast Growth Factor 6) ELISA Kit

Sign In for Pricing
View Details
Porcine FGF6 (Fibroblast Growth Factor 6) ELISA Kit
MBS2509153-03 96 Tests

Porcine FGF6 (Fibroblast Growth Factor 6) ELISA Kit

Sign In for Pricing
View Details