Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INMT Rabbit Polyclonal Antibody (Biotin)

INMT Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TEMT

UniProt

O95050

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human INMT

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_006765

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAP, ID (Seprase, FAP, ) (AP) discontinued
035513-AP 200 µL

FAP, ID (Seprase, FAP, ) (AP) discontinued

Sign In for Pricing
View Details
CNPY3, NT (CNPY3, CTG4A, ERDA5, PRAT4A, TNRC5, Protein canopy homolog 3, CTG repeat protein 4a, Expanded repeat-domain protein CAG/CTG 5, Protein associated with TLR4, Trinucleotide repeat-containing gene 5 protein) (MaxLight 750)
MBS6287337-01 0.1 mL

CNPY3, NT (CNPY3, CTG4A, ERDA5, PRAT4A, TNRC5, Protein canopy homolog 3, CTG repeat protein 4a, Expanded repeat-domain protein CAG/CTG 5, Protein associated with TLR4, Trinucleotide repeat-containing gene 5 protein) (MaxLight 750)

Sign In for Pricing
View Details
CNPY3, NT (CNPY3, CTG4A, ERDA5, PRAT4A, TNRC5, Protein canopy homolog 3, CTG repeat protein 4a, Expanded repeat-domain protein CAG/CTG 5, Protein associated with TLR4, Trinucleotide repeat-containing gene 5 protein) (MaxLight 750)
MBS6287337-02 5x 0.1 mL

CNPY3, NT (CNPY3, CTG4A, ERDA5, PRAT4A, TNRC5, Protein canopy homolog 3, CTG repeat protein 4a, Expanded repeat-domain protein CAG/CTG 5, Protein associated with TLR4, Trinucleotide repeat-containing gene 5 protein) (MaxLight 750)

Sign In for Pricing
View Details
ARIH2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
12363124 3x 1.0µg DNA

ARIH2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
GLRB Rabbit Polyclonal Antibody (Biotin)
orb2134022 100 µL

GLRB Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Phospho-JUN (T239) Antibody
MBS7121625-01 0.05 mg

Phospho-JUN (T239) Antibody

Sign In for Pricing
View Details