Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDF2 Rabbit Polyclonal Antibody (HRP)

SDF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q99470

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SDF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_008854

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBA (Glucosylceramidase, Acid beta-glucosidase, Alglucerase, Beta-glucocerebrosidase, D-glucosyl-N-acylsphingosine Glucohydrolase, Imiglucerase, GC, GLUC) (HRP)
127195-HRP 100 µL

GBA (Glucosylceramidase, Acid beta-glucosidase, Alglucerase, Beta-glucocerebrosidase, D-glucosyl-N-acylsphingosine Glucohydrolase, Imiglucerase, GC, GLUC) (HRP)

Sign In for Pricing
View Details
PNPLA7 Protein Vector (Rat) (pPB-N-His)
PV294967 500 ng

PNPLA7 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
NuaK1 (ARK5) Recombinant Human Active Protein Kinase
HY-E70850 1 Each

NuaK1 (ARK5) Recombinant Human Active Protein Kinase

Sign In for Pricing
View Details
Human ARL4D Knockout HEK293T cell line
GTR15418467 1 Vial

Human ARL4D Knockout HEK293T cell line

Sign In for Pricing
View Details
HBA2, ID (HBA1, Hemoglobin subunit alpha, Alpha-globin, Hemoglobin alpha chain) (AP) discontinued
036444-AP 200 µL

HBA2, ID (HBA1, Hemoglobin subunit alpha, Alpha-globin, Hemoglobin alpha chain) (AP) discontinued

Sign In for Pricing
View Details
Anti-LDL Receptor/LDLR Antibody Picoband® Fluoro550 Conjugated
A00076-2-Fluoro550 100 µg/Vial

Anti-LDL Receptor/LDLR Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details