Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATE1 Rabbit Polyclonal Antibody (FITC)

ATE1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC26724

UniProt

O95260

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ATE1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_008972

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human ACHE Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8422149-01 0.12 mL

Rabbit Anti Human ACHE Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Rabbit Anti Human ACHE Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8422149-02 0.2 mL

Rabbit Anti Human ACHE Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Rabbit Anti Human ACHE Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8422149-03 5x 0.2 mL

Rabbit Anti Human ACHE Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
DDX21, NT (DDX21, Nucleolar RNA helicase 2, DEAD box protein 21, Gu-alpha, Nucleolar RNA helicase Gu, Nucleolar RNA helicase II, RH II/Gu) (MaxLight 750)
MBS6291396-01 0.1 mL

DDX21, NT (DDX21, Nucleolar RNA helicase 2, DEAD box protein 21, Gu-alpha, Nucleolar RNA helicase Gu, Nucleolar RNA helicase II, RH II/Gu) (MaxLight 750)

Sign In for Pricing
View Details
DDX21, NT (DDX21, Nucleolar RNA helicase 2, DEAD box protein 21, Gu-alpha, Nucleolar RNA helicase Gu, Nucleolar RNA helicase II, RH II/Gu) (MaxLight 750)
MBS6291396-02 5x 0.1 mL

DDX21, NT (DDX21, Nucleolar RNA helicase 2, DEAD box protein 21, Gu-alpha, Nucleolar RNA helicase Gu, Nucleolar RNA helicase II, RH II/Gu) (MaxLight 750)

Sign In for Pricing
View Details
UGT2A1 siRNA (Mouse)
orb1838967-01 15 nmol

UGT2A1 siRNA (Mouse)

Sign In for Pricing
View Details