Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HS2ST1 Rabbit Polyclonal Antibody (Biotin)

HS2ST1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NFSRA, dJ604K5.2

UniProt

Q7LGA3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HS2ST1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036394

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WBSCR27, NT (WBSCR27, Williams-Beuren syndrome chromosomal region 27 protein) (MaxLight 490) discontinued
043812-ML490 100 µL

WBSCR27, NT (WBSCR27, Williams-Beuren syndrome chromosomal region 27 protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
IRAK3 cDNA Clone
MBS1268290-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

IRAK3 cDNA Clone

Sign In for Pricing
View Details
IRAK3 cDNA Clone
MBS1268290-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

IRAK3 cDNA Clone

Sign In for Pricing
View Details
Mpst (NM_001162492) Mouse Tagged ORF Clone Lentiviral Particle
MR217240L4V 200 µL

Mpst (NM_001162492) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human CD178 ELISA Set, 20 x 96-well
EA101381 20x 96 Wells

Human CD178 ELISA Set, 20 x 96-well

Sign In for Pricing
View Details
ABL1 Antibody
orb1255042 100 µL

ABL1 Antibody

Sign In for Pricing
View Details