Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gcat Rabbit Polyclonal Antibody (HRP)

Gcat Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Kb, Kbl, AI526977

UniProt

E9PWY6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AQYGALVFVDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGAS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001155184

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBD2 shRNA Plasmid (h)
sc-35865-SH 20 µg

MBD2 shRNA Plasmid (h)

Sign In for Pricing
View Details
ARHGAP1, ID (ARHGAP1, CDC42GAP, RHOGAP1, Rho GTPase-activating protein 1, CDC42 GTPase-activating protein, GTPase-activating protein rhoOGAP, Rho-related small GTPase protein activator, Rho-type GTPase-activating protein 1, p50-RhoGAP) (MaxLight 750)
MBS6274839-01 0.1 mL

ARHGAP1, ID (ARHGAP1, CDC42GAP, RHOGAP1, Rho GTPase-activating protein 1, CDC42 GTPase-activating protein, GTPase-activating protein rhoOGAP, Rho-related small GTPase protein activator, Rho-type GTPase-activating protein 1, p50-RhoGAP) (MaxLight 750)

Sign In for Pricing
View Details
ARHGAP1, ID (ARHGAP1, CDC42GAP, RHOGAP1, Rho GTPase-activating protein 1, CDC42 GTPase-activating protein, GTPase-activating protein rhoOGAP, Rho-related small GTPase protein activator, Rho-type GTPase-activating protein 1, p50-RhoGAP) (MaxLight 750)
MBS6274839-02 5x 0.1 mL

ARHGAP1, ID (ARHGAP1, CDC42GAP, RHOGAP1, Rho GTPase-activating protein 1, CDC42 GTPase-activating protein, GTPase-activating protein rhoOGAP, Rho-related small GTPase protein activator, Rho-type GTPase-activating protein 1, p50-RhoGAP) (MaxLight 750)

Sign In for Pricing
View Details
LYPLA3 Double Nickase Plasmid (m)
sc-431424-NIC 20 µg

LYPLA3 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to Cluster Of Differentiation 34 (CD34)
MBS2134319-01 0.1 mL

HRP Linked Monoclonal Antibody to Cluster Of Differentiation 34 (CD34)

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to Cluster Of Differentiation 34 (CD34)
MBS2134319-02 0.2 mL

HRP Linked Monoclonal Antibody to Cluster Of Differentiation 34 (CD34)

Sign In for Pricing
View Details