Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tnik Rabbit Polyclonal Antibody (HRP)

Tnik Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI451411, 1500031A17Rik, 4831440I19Rik, C530008O15Rik, C630040K21Rik

UniProt

P83510

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DSGAEYGIGSSTKASFTPFVDPRVYQTSPTDEDEEDDESSAAALFTSELL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

145kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001156480

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Substance P Polyclonal Antibody Bio Conjugated
MBS9462067-01 0.1 mL

Substance P Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
Substance P Polyclonal Antibody Bio Conjugated
MBS9462067-02 5x 0.1 mL

Substance P Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
MPP2 Polyclonal Antibody
MBS9126525-01 0.02 mL

MPP2 Polyclonal Antibody

Sign In for Pricing
View Details
MPP2 Polyclonal Antibody
MBS9126525-02 0.1 mL

MPP2 Polyclonal Antibody

Sign In for Pricing
View Details
MPP2 Polyclonal Antibody
MBS9126525-03 5x 0.1 mL

MPP2 Polyclonal Antibody

Sign In for Pricing
View Details
CD28 (MGC138290, T cell Antigen CD28, T cell Specific Surface Glycoprotein CD28, Tp44) (MaxLight 405) discontinued
C2380-09EX-ML405 100 µL

CD28 (MGC138290, T cell Antigen CD28, T cell Specific Surface Glycoprotein CD28, Tp44) (MaxLight 405) discontinued

Sign In for Pricing
View Details