Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPT1 Rabbit Polyclonal Antibody (HRP)

LIPT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LIPT1D

UniProt

Q9Y234

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LIPT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ube2j1 Pre-designed siRNA Set B
SI115582B 1 Each

Mouse Ube2j1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Sheep Islet amyloid polypeptide, IAPP ELISA Kit
MBS1602061-01 48 Well

Sheep Islet amyloid polypeptide, IAPP ELISA Kit

Sign In for Pricing
View Details
Sheep Islet amyloid polypeptide, IAPP ELISA Kit
MBS1602061-02 96 Well

Sheep Islet amyloid polypeptide, IAPP ELISA Kit

Sign In for Pricing
View Details
Sheep Islet amyloid polypeptide, IAPP ELISA Kit
MBS1602061-03 5x 96 Well

Sheep Islet amyloid polypeptide, IAPP ELISA Kit

Sign In for Pricing
View Details
Sheep Islet amyloid polypeptide, IAPP ELISA Kit
MBS1602061-04 10x 96 Well

Sheep Islet amyloid polypeptide, IAPP ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Extracellular Phosphoglycoprotein (MEPE) ELISA Kit
orb1664875-01 48 Tests

Rat Matrix Extracellular Phosphoglycoprotein (MEPE) ELISA Kit

Sign In for Pricing
View Details