Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLK Rabbit Polyclonal Antibody (Biotin)

POLK Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DINP, POLQ, DINB1

UniProt

Q9UBT6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POLK

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_057302

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED31 (Mediator of RNA Polymerase II Transcription Subunit 31, Mediator Complex Subunit 31, Mediator Complex Subunit SOH1, hSOH1, SOH1, CGI-125, 3110004H13Rik, CGI-125, FLJ27436, FLJ36714, hSOH1)
MBS6010796-01 0.05 mg

MED31 (Mediator of RNA Polymerase II Transcription Subunit 31, Mediator Complex Subunit 31, Mediator Complex Subunit SOH1, hSOH1, SOH1, CGI-125, 3110004H13Rik, CGI-125, FLJ27436, FLJ36714, hSOH1)

Sign In for Pricing
View Details
MED31 (Mediator of RNA Polymerase II Transcription Subunit 31, Mediator Complex Subunit 31, Mediator Complex Subunit SOH1, hSOH1, SOH1, CGI-125, 3110004H13Rik, CGI-125, FLJ27436, FLJ36714, hSOH1)
MBS6010796-02 5x 0.05 mg

MED31 (Mediator of RNA Polymerase II Transcription Subunit 31, Mediator Complex Subunit 31, Mediator Complex Subunit SOH1, hSOH1, SOH1, CGI-125, 3110004H13Rik, CGI-125, FLJ27436, FLJ36714, hSOH1)

Sign In for Pricing
View Details
Canine Acyl-coenzyme A thioesterase 11 (ACOT11) ELISA Kit
GTR10320729 96 Well

Canine Acyl-coenzyme A thioesterase 11 (ACOT11) ELISA Kit

Sign In for Pricing
View Details
Tas2r138 (NM_001001451) Mouse Tagged ORF Clone Lentiviral Particle
MR220713L4V 200 µL

Tas2r138 (NM_001001451) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C19orf62 Over-expression Lysate Product
GWB-F09FD6 0.1 mg

C19orf62 Over-expression Lysate Product

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Cyclic nucleotide-gated cation channel (Cng)
MBS7011824-01 0.02 mg

Recombinant Drosophila melanogaster Cyclic nucleotide-gated cation channel (Cng)

Sign In for Pricing
View Details