Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSF1 Rabbit Polyclonal Antibody (HRP)

RSF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

XAP8, p325, HBXAP, RSF-1

UniProt

Q96T23

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RSF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

164kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057662

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIAF1 (TGFB1-Induced anti-Apoptotic Factor 1, MAJN, MYO18A, MYSPDZ, SPR210) (MaxLight 405) discontinued
252643-ML405 100 µL

TIAF1 (TGFB1-Induced anti-Apoptotic Factor 1, MAJN, MYO18A, MYSPDZ, SPR210) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Itk (IL-2 Inducible T-cell Kinase, Emt, Kinase EMT, LYK, MGC126257, MGC126258, PSCTK2, T Cell Signaling Protein, T-cell-specific Kinase, Tsk, Tyrosine Protein Kinase ITK/TSK, Tyrosine-protein Kinase Lyk) (MaxLight 650)
MBS6483686-01 0.1 mL

Itk (IL-2 Inducible T-cell Kinase, Emt, Kinase EMT, LYK, MGC126257, MGC126258, PSCTK2, T Cell Signaling Protein, T-cell-specific Kinase, Tsk, Tyrosine Protein Kinase ITK/TSK, Tyrosine-protein Kinase Lyk) (MaxLight 650)

Sign In for Pricing
View Details
Itk (IL-2 Inducible T-cell Kinase, Emt, Kinase EMT, LYK, MGC126257, MGC126258, PSCTK2, T Cell Signaling Protein, T-cell-specific Kinase, Tsk, Tyrosine Protein Kinase ITK/TSK, Tyrosine-protein Kinase Lyk) (MaxLight 650)
MBS6483686-02 5x 0.1 mL

Itk (IL-2 Inducible T-cell Kinase, Emt, Kinase EMT, LYK, MGC126257, MGC126258, PSCTK2, T Cell Signaling Protein, T-cell-specific Kinase, Tsk, Tyrosine Protein Kinase ITK/TSK, Tyrosine-protein Kinase Lyk) (MaxLight 650)

Sign In for Pricing
View Details
1-[4- (Difluoromethoxy) -3-methoxyphenyl]ethan-1-one
BEA97520 2.5 g

1-[4- (Difluoromethoxy) -3-methoxyphenyl]ethan-1-one

Sign In for Pricing
View Details
ER780 Anti-Human CD40 Antibody
JOT22878F 20Tests

ER780 Anti-Human CD40 Antibody

Sign In for Pricing
View Details
Recombinant Human CRLF1 Protein, N-His
orb2962845-01 50 µg

Recombinant Human CRLF1 Protein, N-His

Sign In for Pricing
View Details