Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ3 Rabbit Polyclonal Antibody (HRP)

COQ3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DHHBMT, bA9819.1, DHHBMTASE, UG0215E05

UniProt

Q9NZJ6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human COQ3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARLYSTSQTTVDSGEVKTFLALAHKWWDEQGVYAPLHSMNDLRVPFIRDN

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_059117

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD2/CD2 Antibody Picoband®, APC Conjugate
PA1743-APC 100 µg/Vial

Anti-CD2/CD2 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
GAS1 (NM_002048) Human Tagged Lenti ORF Clone
RC224804L1 10 µg

GAS1 (NM_002048) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Hepatocyte Nuclear Factor 1 Beta (HNF1b) CLIA Kit
EKU09584 96 Tests

Human Hepatocyte Nuclear Factor 1 Beta (HNF1b) CLIA Kit

Sign In for Pricing
View Details
3- (1H-Indol-3-yl) -2- (naphthalen-2-ylformamido) propanoic acid
WFC96907-01 0.5 g

3- (1H-Indol-3-yl) -2- (naphthalen-2-ylformamido) propanoic acid

Sign In for Pricing
View Details
3- (1H-Indol-3-yl) -2- (naphthalen-2-ylformamido) propanoic acid
WFC96907-02 5 g

3- (1H-Indol-3-yl) -2- (naphthalen-2-ylformamido) propanoic acid

Sign In for Pricing
View Details
Blzf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6419807 1.0 µg DNA

Blzf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details