Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ3 Rabbit Polyclonal Antibody (Biotin)

COQ3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DHHBMT, bA9819.1, DHHBMTASE, UG0215E05

UniProt

Q9NZJ6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human COQ3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CGGGLLTEPLGRLGASVIGIDPVDENIKTAQCHKSFDPVLDKRIEYRVCS

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_059117

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DKK1 Rabbit Polyclonal Antibody (Cy5)
orb905215 100 µL

DKK1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
SHIP2 (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2, SH2 Domain-containing Inositol-5'-phosphatase 2, SH2 Domain-containing Inositol Phosphatase 2, SHIP-2, Inositol Polyphosphate Phosphatase-like Protein 1, INPPL-1, Protein 51C, INPPL1) (MaxLight 750) discontinued
133324-ML750 100 µL

SHIP2 (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2, SH2 Domain-containing Inositol-5'-phosphatase 2, SH2 Domain-containing Inositol Phosphatase 2, SHIP-2, Inositol Polyphosphate Phosphatase-like Protein 1, INPPL-1, Protein 51C, INPPL1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SARS-CoV-2 RBD (KP.2) Neutralizing Human Monoclonal Antibody
orb2956781-01 100 µg

SARS-CoV-2 RBD (KP.2) Neutralizing Human Monoclonal Antibody

Sign In for Pricing
View Details
SARS-CoV-2 RBD (KP.2) Neutralizing Human Monoclonal Antibody
orb2956781-02 1 mg

SARS-CoV-2 RBD (KP.2) Neutralizing Human Monoclonal Antibody

Sign In for Pricing
View Details
Gm14347 ORF Vector (Mouse) (pORF)
ORF045794 1.0 µg DNA

Gm14347 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse DR6 Recombinant Protein Fc Tag Lyophilized
MBS8434056-01 0.05 mg

Mouse DR6 Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details