Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ftsj3 Rabbit Polyclonal Antibody (HRP)

Ftsj3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ftsj3

UniProt

Q5RJT2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQRKEQKRNHRRK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

100kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001012014

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Direct Total Iron colorimetric assay (Serum etc), 480 tests
1230-5 1 Kit

Direct Total Iron colorimetric assay (Serum etc), 480 tests

Sign In for Pricing
View Details
Human Ferritin Matched Antibody Pair Set [ABP-S-07175]
ABP-S-07175 5 Plates

Human Ferritin Matched Antibody Pair Set [ABP-S-07175]

Sign In for Pricing
View Details
Recombinant Anguilla japonica C-type natriuretic peptide (cnp)
CSB-YP323831BZH-01 20 µg

Recombinant Anguilla japonica C-type natriuretic peptide (cnp)

Sign In for Pricing
View Details
Recombinant Anguilla japonica C-type natriuretic peptide (cnp)
CSB-YP323831BZH-02 100 µg

Recombinant Anguilla japonica C-type natriuretic peptide (cnp)

Sign In for Pricing
View Details
Recombinant Anguilla japonica C-type natriuretic peptide (cnp)
CSB-YP323831BZH-03 1 mg

Recombinant Anguilla japonica C-type natriuretic peptide (cnp)

Sign In for Pricing
View Details
Recombinant Prosthecochloris aestuarii ATP synthase subunit a 1 (atpB1)
MBS1010209 Inquire

Recombinant Prosthecochloris aestuarii ATP synthase subunit a 1 (atpB1)

Sign In for Pricing
View Details