Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT61B Rabbit Polyclonal Antibody (FITC)

TRMT61B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TRMT61B

UniProt

Q9BVS5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRMT61B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SKINTDVQLDSQEKIGVKGELFQEDDHEESHSDFPYGSFPYVARPVHWQP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_060380

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLSCR5 CRISPRa sgRNA lentivector (set of three targets)(Rat)
37037126 3x 1.0µg DNA

PLSCR5 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
RECQL5, ID (RECQL5, RECQ5, ATP-dependent DNA helicase Q5, DNA helicase, RecQ-like type 5, RecQ protein-like 5) (MaxLight 490) discontinued
040941-ML490 100 µL

RECQL5, ID (RECQL5, RECQ5, ATP-dependent DNA helicase Q5, DNA helicase, RecQ-like type 5, RecQ protein-like 5) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Monkey eye syndrome critical region protein 6 (CECR6) ELISA Kit
GTR10343953 96 Well

Monkey eye syndrome critical region protein 6 (CECR6) ELISA Kit

Sign In for Pricing
View Details
Anti-CYP4F2 Antibody Picoband® PE Conjugated
A01737-2-PE 100 µg/Vial

Anti-CYP4F2 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
PPP1R2P3 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 2 Pseudogene 3, MGC87149)
250397 200 µL

PPP1R2P3 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 2 Pseudogene 3, MGC87149)

Sign In for Pricing
View Details
3- (4-Bromophenyl) pyrrolidin-3-ol hydrochloride
SCA46631-01 100 mg

3- (4-Bromophenyl) pyrrolidin-3-ol hydrochloride

Sign In for Pricing
View Details