Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pcmtd2 Rabbit Polyclonal Antibody (Biotin)

Pcmtd2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI314201, 5330414D10Rik

UniProt

Q8BHD8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Pcmtd2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LDKEVFASRISNPSDDTSCEDAEEDRREVAERTLQETKPEPPVNFLRQRV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_705822

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Hormone-sensitive lipase ELISA Kit
MBS289463-01 48 Well

Human Hormone-sensitive lipase ELISA Kit

Sign In for Pricing
View Details
Human Hormone-sensitive lipase ELISA Kit
MBS289463-02 96 Well

Human Hormone-sensitive lipase ELISA Kit

Sign In for Pricing
View Details
Human Hormone-sensitive lipase ELISA Kit
MBS289463-03 5x 96 Well

Human Hormone-sensitive lipase ELISA Kit

Sign In for Pricing
View Details
Human Hormone-sensitive lipase ELISA Kit
MBS289463-04 10x 96 Well

Human Hormone-sensitive lipase ELISA Kit

Sign In for Pricing
View Details
Cyp1b1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3934906 1.0 µg DNA

Cyp1b1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
DACH1, ID (DACH1, DACH, Dachshund homolog 1) (Biotin)
MBS6290685-01 0.2 mL

DACH1, ID (DACH1, DACH, Dachshund homolog 1) (Biotin)

Sign In for Pricing
View Details