Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECHDC2 Rabbit Polyclonal Antibody (FITC)

ECHDC2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ10948

UniProt

Q86YB7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ECHDC2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060751

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psmd5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6148506 1.0 µg DNA

Psmd5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Ubn1 (NM_026666) Mouse Tagged ORF Clone Lentiviral Particle
MR211689L4V 200 µL

Ubn1 (NM_026666) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C1orf222 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
14192111 3x 1.0 µg

C1orf222 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human DPEP1 sgRNA gene knockout kit - Lentiviral human DPEP1 sgRNA gene knockout kit (25)
GTR15372960 1 Vial

Lentiviral human DPEP1 sgRNA gene knockout kit - Lentiviral human DPEP1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
MIR5107 Mouse qPCR Primer Pair (MI0018016)
MP300719 200 Reactions

MIR5107 Mouse qPCR Primer Pair (MI0018016)

Sign In for Pricing
View Details
Peptidyl Arginine Deiminase Type III (PADI3) Antibody
abx301745-01 20 µg

Peptidyl Arginine Deiminase Type III (PADI3) Antibody

Sign In for Pricing
View Details