Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nudt15 Rabbit Polyclonal Antibody (Biotin)

Nudt15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MTH2, 6530403O17, A730068G11Rik

UniProt

Q8BG93

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLHLKNVCFASVVNS

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766115

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospholipase C gamma 1 (PLCG1) Rabbit Polyclonal Antibody
TA384993 100 µL

Phospholipase C gamma 1 (PLCG1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZSCAN1 activation kit by CRISPRa
GA117119 1 Kit

Human ZSCAN1 activation kit by CRISPRa

Sign In for Pricing
View Details
Rhod-2, AM Ester
50023 10x 100 µg

Rhod-2, AM Ester

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS500003 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-100 1x 100 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human TEM8/ATR Protein (His Tag)
PKSH033297-01 10 µg

Recombinant Human TEM8/ATR Protein (His Tag)

Sign In for Pricing
View Details